PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Csa05g011720.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Camelina
Family bZIP
Protein Properties Length: 728aa    MW: 78778.1 Da    PI: 5.5803
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Csa05g011720.1genomeCSGPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_141.62.7e-13229290162
                     XXXXCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
          bZIP_1   1 ekelkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklkse 62 
                     e++ k+  r+++NRe+A+ sRqRKk ++eeLeekv ++ +  ++L  +++    e a+l+++
  Csa05g011720.1 229 EEDEKKKARLMRNRESAQLSRQRKKHYVEELEEKVRNMHSTITDLNGKISYFMAENATLRQQ 290
                     678899******************************************99999999999887 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003382.5E-16229293IPR004827Basic-leucine zipper domain
PfamPF001703.1E-11230291IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.3231291IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1705.9E-17233291No hitNo description
SuperFamilySSF579593.81E-12233291No hitNo description
CDDcd147041.23E-21234285No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0042538Biological Processhyperosmotic salinity response
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0005783Cellular Componentendoplasmic reticulum
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 728 aa     Download sequence    Send to blast
MAEPITEQPP PPAPDPNSTH PPPSDFDSIS IPPFDDHFGS DQTPIGELMS DLGFPDGEFE  60
LTFDGMDDLY FPAENESFLI PINTSTQEEH FGDFTPESEA SGISGDSLLP KDDAVTISGC  120
CNRESPRDDS DDRCSGADRT LDLPTPLSSQ GSGNCGSDVS EATNESSPKS GNVVVDQKVK  180
VEEAVVATTT TSSITKRKKE IEEDLSDESR NSKYRRSGED ADASAVTGEE DEKKKARLMR  240
NRESAQLSRQ RKKHYVEELE EKVRNMHSTI TDLNGKISYF MAENATLRQQ LGGNGMCPPH  300
HPPPPMGMYP PMAPMPYPWM PCPPYMVKQQ GSQVPLIPIP RLKPQNPLGT SKAKKSESKK  360
SEAKTKKVAS ISFLGLLFCL FLFGALAPIV NVNYGGISGA FYGNYRSNYI TDQVYSQHRD  420
RVLDASRSGA GTGVSNSNNG IHCGRDSDQG TRKNISATDS SVPPGNGSEP LVASLFVPRN  480
DKLVKIDGNL IINSILASEK AVASRKASES NERNADLVIP KDYSPALPLP DVGRTEEMAK  540
HLYRSKAEKQ KALSSGSADT LKDQFKTIAA NGEMQQWFRE GVAGPMFSSG MCTEVFQFDV  600
SSTSGAIIPA TPATNVSAEH GKNTTDTHKR KNRRILRGLP IPLPGSDFNL TKEHQRNSSS  660
KEIKPASSMV VSVLVDPREG GDGDIEGMIG GPKSLSRVFV VVLLDSAKYV TYSCVLPRSG  720
APHLVTT*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY1362950.0AY136295.1 Arabidopsis thaliana putative TGACG-sequence-specific bZIP DNA-binding protein (At2g40950) mRNA, complete cds.
GenBankBT0004080.0BT000408.1 Arabidopsis thaliana putative TGACG-sequence-specific bZIP DNA-binding protein (At2g40950) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010508785.10.0PREDICTED: uncharacterized protein LOC104785300
SwissprotO222080.0BZP17_ARATH; bZIP transcription factor 17
TrEMBLD7LGH50.0D7LGH5_ARALL; BZIP transcription factor family protein
STRINGscaffold_402899.10.0(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM88812737
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G40950.10.0bZIP family protein